| ID | DRAMP00145 |
|---|---|
| Sequence | GMSGYIQGIPDFLKGYLHGISAANKHKKGRL |
| Length | 31 |
| Name | Lactocin-705 (Bacteriocin) |
| Source | Lactobacillus plantarum (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | several lactic acid bacteria, Listeria, Streptococci, etc. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P80959 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8796440 |
Physicochemical Properties
| Residues | 31 |
|---|---|
| Sequence | GMSGYIQGIPDFLKGYLHGISAANKHKKGRL |
| Molecular Weight | 3357.883 |
| Grand Average of Hydropathy | -0.387 |
| Isoelectric Point | 9.998 |
| Charge at pH 7.4 | 3.616 |
| Secondary Structure | Helix: 0.290, Turn: 0.323, Sheet: 0.194 |
| Instability Index | 10.819 |
| Aromaticity | 0.097 |