| ID | DRAMP01187 |
|---|---|
| Sequence | FTLKKSQLLLFFLGTINFSLCEEERNAEEERRDYPEEKDVEVEKR |
| Length | 45 |
| Name | Chensinin-3CE (Frogs, amphibians, animals) |
| Source | Rana chensinensis (Chinese brown frog) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 21303203 |
Physicochemical Properties
| Residues | 45 |
|---|---|
| Sequence | FTLKKSQLLLFFLGTINFSLCEEERNAEEERRDYPEEKDVEVEKR |
| Molecular Weight | 5480.08 |
| Grand Average of Hydropathy | -0.916 |
| Isoelectric Point | 4.705 |
| Charge at pH 7.4 | -4.468 |
| Secondary Structure | Helix: 0.311, Turn: 0.133, Sheet: 0.378 |
| Instability Index | 72.487 |
| Aromaticity | 0.111 |