| ID | DRAMP02392 |
|---|---|
| Sequence | GWFKKAWRKVKNAGRVLKGVGIHYGVGLIG |
| Length | 30 |
| Name | Hematopoietic antimicrobial peptide-29 (MgCath29; hagfishes, chordates, animals) |
| Source | Myxine glutinosa (Atlantic hagfish) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q71MD5 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15019197 |
Physicochemical Properties
| Residues | 30 |
|---|---|
| Sequence | GWFKKAWRKVKNAGRVLKGVGIHYGVGLIG |
| Molecular Weight | 3295.926 |
| Grand Average of Hydropathy | -0.043 |
| Isoelectric Point | 11.264 |
| Charge at pH 7.4 | 6.579 |
| Secondary Structure | Helix: 0.400, Turn: 0.267, Sheet: 0.133 |
| Instability Index | 6.76 |
| Aromaticity | 0.133 |