| ID | DRAMP02417 |
|---|---|
| Sequence | MVRARRGCGCPLNQGACHRHCKSIGRRGGYCAGFLKQTCTCYRN |
| Length | 44 |
| Name | Defensin (Ticks, Arthropods, animals) |
| Source | Ornithodoros coriaceus (Soft tick) (Argasid tick) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | B2D2C0 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 18725333 |
Physicochemical Properties
| Residues | 44 |
|---|---|
| Sequence | MVRARRGCGCPLNQGACHRHCKSIGRRGGYCAGFLKQTCTCYRN |
| Molecular Weight | 4890.715 |
| Grand Average of Hydropathy | -0.568 |
| Isoelectric Point | 9.89 |
| Charge at pH 7.4 | 8.176 |
| Secondary Structure | Helix: 0.159, Turn: 0.250, Sheet: 0.136 |
| Instability Index | 65.145 |
| Aromaticity | 0.068 |