| ID | DRAMP03720 |
|---|---|
| Sequence | GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCTCYRN |
| Length | 38 |
| Name | 4 kDa defensin (Antibacterial 4 kDa peptide; Arthropods, animals) |
| Source | Leiurus quinquestriatus hebraeus (Yellow scorpion) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P41965 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8333834 |
Physicochemical Properties
| Residues | 38 |
|---|---|
| Sequence | GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCTCYRN |
| Molecular Weight | 4325.948 |
| Grand Average of Hydropathy | -0.653 |
| Isoelectric Point | 9.692 |
| Charge at pH 7.4 | 6.476 |
| Secondary Structure | Helix: 0.184, Turn: 0.263, Sheet: 0.079 |
| Instability Index | 85.929 |
| Aromaticity | 0.132 |
