Basic Information
| ID | DRAMP02427 |
|---|
| Sequence | GGYYCPFFQDKCHRHCRSFGRKAGYCGGFLKKTCICV |
|---|
| Length | 37 |
|---|
| Name | Ixodes ricinus defensin def1 (Ticks, Arthropods, animals) |
|---|
| Source | Ixodes ricinus (European tick) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
|---|
| Pathogen | Gram-positive bacteria: Bacillus subtilis (MIC=1.5 µM), Micrococcus luteus(MIC=0.75 µM), Staphylococcus aureus (MRSA) (MIC=50 µM). |
|---|
| Hemolytic Activity | [Ref.21504572] It has 2.9% and 75% hemolysis at concentrations of 12.5 μM and 100 μM against human erythrocytes . |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Free |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 21504572 |
|---|
