| ID | DRAMP02420 |
|---|---|
| Sequence | FDNPFGCPADEGKCFDHCNNKAYDIGYCGGSYRATCVCYRK |
| Length | 41 |
| Name | Amblyomma defensin peptide 1 (ADP-1; Ticks, Arthropods, animals) |
| Source | Amblyomma hebraeum (Tick) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 14705963 |
Physicochemical Properties
| Residues | 41 |
|---|---|
| Sequence | FDNPFGCPADEGKCFDHCNNKAYDIGYCGGSYRATCVCYRK |
| Molecular Weight | 4590.076 |
| Grand Average of Hydropathy | -0.641 |
| Isoelectric Point | 6.707 |
| Charge at pH 7.4 | -0.568 |
| Secondary Structure | Helix: 0.220, Turn: 0.268, Sheet: 0.098 |
| Instability Index | 27.427 |
| Aromaticity | 0.171 |