Basic Information
| ID | DRAMP02419 |
|---|
| Sequence | YENPYGCPTDEGKCFDRCNDSEFEGGYCGGSYRATCVCYRT |
|---|
| Length | 41 |
|---|
| Name | Amblyomma defensin peptide 2 (ADP-2; Ticks, Arthropods, animals) |
|---|
| Source | Amblyomma hebraeum (Tick) |
|---|
| Activity | Antimicrobial, Antibacterial |
|---|
| Pathogen | Escherichia coli (MIC=30 µM) and Staphylococcus aureus (MIC=7.5 µM). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Free |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 14705963 |
|---|
