| ID | DRAMP00999 |
|---|---|
| Sequence | GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY |
| Length | 40 |
| Name | Plectasin (fungal defensin) |
| Source | Pseudoplectania nigrella (Ebony cup) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Antifungal |
| Pathogen | Gram-positive bacterium: Streptococcus pneumoniae. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q53I06 |
| PDB | 1ZFU |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16222292 |
Physicochemical Properties
| Residues | 40 |
|---|---|
| Sequence | GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY |
| Molecular Weight | 4407.966 |
| Grand Average of Hydropathy | -0.695 |
| Isoelectric Point | 7.771 |
| Charge at pH 7.4 | 0.466 |
| Secondary Structure | Helix: 0.200, Turn: 0.300, Sheet: 0.075 |
| Instability Index | 13.822 |
| Aromaticity | 0.15 |