| ID | DRAMP03719 |
|---|---|
| Sequence | GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCCYRN |
| Length | 37 |
| Name | Scorpion defensin (Arthropods, animals) |
| Source | Leiurus quinquestriatus |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8333834 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCCYRN |
| Molecular Weight | 4224.844 |
| Grand Average of Hydropathy | -0.651 |
| Isoelectric Point | 9.692 |
| Charge at pH 7.4 | 6.476 |
| Secondary Structure | Helix: 0.189, Turn: 0.270, Sheet: 0.081 |
| Instability Index | 79.17 |
| Aromaticity | 0.135 |