Basic Information
| ID | DRAMP20801 |
|---|
| Sequence | GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLPCTCYRC |
|---|
| Length | 38 |
|---|
| Name | Mussel Defensin MGD-1 (Mediterranean mussel defensin 1; mollusca/molluscs/mollusks, invertebrates, animals) |
|---|
| Source | Mytilus galloprovincialis (Mediterranean mussel) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
|---|
| Pathogen | [Ref.8925841] Gram-positive bacteria: Micrococcus luteus (MIC=0.08 μg/ml);##Gram-negative bacteria: Escherichia coli (MIC=6.4 μg/ml), Vibrio alginolyticus (MIC=6.4 μg/ml), Vibrio splendidus (MIC=1.6 μg/ml), Vibrio P1 (MIC=6.4 μg/ml). |
|---|
| Hemolytic Activity | [Ref.8925841] The plasma is capable of causing 20% of the total hemolysis. |
|---|
| Cytotoxicity | [Ref.8925841] The protozoan P. marinus is not killed by pure peptide, even at a concentration of 16 μg/ml. |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Amidation |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
P80571 |
|---|
| PDB |
1FJN resolved by NMR |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 8925841 |
|---|
