| ID | DRAMP02475 |
|---|---|
| Sequence | NEKSGSCPDMSMPIPPLGICKTLCNSDSGCPNVQKCCKNGCGFMTCTTPVP |
| Length | 51 |
| Name | Nawaprin (Snakes, reptiles, animals) |
| Source | Naja nigricollis (Black-necked spitting cobra) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P60589, P83769 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12878611 |
Physicochemical Properties
| Residues | 51 |
|---|---|
| Sequence | NEKSGSCPDMSMPIPPLGICKTLCNSDSGCPNVQKCCKNGCGFMTCTTPVP |
| Molecular Weight | 5296.195 |
| Grand Average of Hydropathy | -0.198 |
| Isoelectric Point | 7.69 |
| Charge at pH 7.4 | 0.353 |
| Secondary Structure | Helix: 0.137, Turn: 0.412, Sheet: 0.118 |
| Instability Index | 55.259 |
| Aromaticity | 0.02 |