| ID | DRAMP02615 |
|---|---|
| Sequence | DHYNCVRSGGQCLYSACPIYTRIQGTCYHGKAKCCK |
| Length | 36 |
| Name | Beta-defensin 1 (BD-1; Defensin, beta 1; primates, mammals, animals) |
| Source | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P61261, A4H1Z6 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16700051 |
Physicochemical Properties
| Residues | 36 |
|---|---|
| Sequence | DHYNCVRSGGQCLYSACPIYTRIQGTCYHGKAKCCK |
| Molecular Weight | 4028.623 |
| Grand Average of Hydropathy | -0.469 |
| Isoelectric Point | 8.871 |
| Charge at pH 7.4 | 3.467 |
| Secondary Structure | Helix: 0.222, Turn: 0.222, Sheet: 0.083 |
| Instability Index | 48.95 |
| Aromaticity | 0.111 |