| ID | DRAMP03161 |
|---|---|
| Sequence | DHYNCVKGGGQCLYSACPIYTKVQGTCYGGKAKCCK |
| Length | 36 |
| Name | Beta-defensin 1 (BD-1; Defensin, beta 1; mammals, animals), |
| Source | Saguinus oedipus (Cotton-top tamarin) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q95M66 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11862391 |
Physicochemical Properties
| Residues | 36 |
|---|---|
| Sequence | DHYNCVKGGGQCLYSACPIYTKVQGTCYGGKAKCCK |
| Molecular Weight | 3848.456 |
| Grand Average of Hydropathy | -0.356 |
| Isoelectric Point | 8.842 |
| Charge at pH 7.4 | 3.425 |
| Secondary Structure | Helix: 0.222, Turn: 0.250, Sheet: 0.083 |
| Instability Index | 35.178 |
| Aromaticity | 0.111 |