| ID | DRAMP02965 |
|---|---|
| Sequence | GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGC |
| Length | 35 |
| Name | PMAP-36(1-35)2 |
| Source | Sus scrofa (Pig) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
| Pathogen | Gram-positive bacteria: Staphylococcus aureus ATCC 25923 (MIC=2 µM), S. aureus 710A (MIC=2 µM), S. aureus SA-62 (MRSA) (MIC=4 µM), Bacillus megaterium Bm11 (MIC=1 µM), S. epidermidis ATCC 12228 (MIC=1 µM);##Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC=1 µM), E. coli ML35 (MIC=0.5 µM), E. coli D21 (MIC=0.5 µM), E. coli D22 (MIC=0.5 µM), S. enterica ser. Typhimurium ATCC 14028 (MIC=1 µM), S. enterica ser. Enteritidis H2 (MIC=0.5 µM), P. aeruginosa ATCC 27853 (MIC=1 µM), S. marcescens ATCC 8100 (MIC=2 µM).##Fungi: Candida albicans c.i. (MIC=16 µM), Cryptococcus neoformans c.i.(MIC=2 µM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16128809 |
Physicochemical Properties
| Residues | 35 |
|---|---|
| Sequence | GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGC |
| Molecular Weight | 4100.117 |
| Grand Average of Hydropathy | -0.463 |
| Isoelectric Point | 12 |
| Charge at pH 7.4 | 12.515 |
| Secondary Structure | Helix: 0.343, Turn: 0.229, Sheet: 0.114 |
| Instability Index | 27.774 |
| Aromaticity | 0.057 |