| ID | DRAMP02967 |
|---|---|
| Sequence | RADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK |
| Length | 32 |
| Name | Antibacterial peptide 3910 (AP 3910; pigs, mammals, animals) |
| Source | Sus scrofa (Pig) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacterium: Bacillus megaterium. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P80230, P37110 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8375398 |
Physicochemical Properties
| Residues | 32 |
|---|---|
| Sequence | RADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK |
| Molecular Weight | 3910.398 |
| Grand Average of Hydropathy | -1.331 |
| Isoelectric Point | 9.871 |
| Charge at pH 7.4 | 3.542 |
| Secondary Structure | Helix: 0.281, Turn: 0.094, Sheet: 0.188 |
| Instability Index | 41.397 |
| Aromaticity | 0.125 |