Basic Information
| ID | DRAMP02984 |
|---|
| Sequence | GLRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI |
|---|
| Length | 43 |
|---|
| Name | Neutrophil cationic antibacterial polypeptide of 11 kDa (CAP11; pigs, mammals, animals) |
|---|
| Source | Cavia porcellus (Domestic guinea pig) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
|---|
| Pathogen | Gram-negative bacterium: Escherichia coli (ED50=30-35 nM);##Gram-positive bacterium: Staphylococcus aureus (ED50=90-120 nM). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
Q91X12 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 8644997 |
|---|
