Basic Information
| ID | DRAMP03797 |
|---|
| Sequence | GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY |
|---|
| Length | 37 |
|---|
| Name | CAP7 (C-terminal fragment of CAP18; lagomorphs, mammals, animals) |
|---|
| Source | Oryctolagus cuniculus (Rabbit) |
|---|
| Activity | Antimicrobial, Antibacterial |
|---|
| Pathogen | [No NaCl]: Escherichia coli DH5a (MIC=0.19 µM), Escherichia coli ML-35p (MIC=0.05 µM), Pseudomonas aeruginosa PAO1 (MIC=0.2 µM), Pseudomonas aeruginosa MR3007 (MIC=0.05 µM), Staphylococcus aureus ATCC (MRSA) 33591 (MIC=1.24 µM), Staphylococcus aureus 93918 (MIC=0.41 µM).##[100 mM NaCl]: Escherichia coli DH5a (MIC=0.21 µM), Escherichia coli ML-35p (MIC=0.09 µM), Pseudomonas aeruginosa PAO1 (MIC=0.62 µM), Pseudomonas aeruginosa MR3007 (MIC=0.36 µM), Staphylococcus aureus ATCC (MRSA) 33591 (MIC=1.36 µM), Staphylococcus aureus 93918 (MIC=0.63 µM). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
P25230 |
|---|
| PDB |
1LYP |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 8132348, 10768969, 7649303 |
|---|
