| ID | DRAMP02391 |
|---|---|
| Sequence | GWFKKAWRKVKHAGRRVLDTAKGVGRHYLNNWLNRYRG |
| Length | 38 |
| Name | Hematopoietic antimicrobial peptide-37 (MgCath37; hagfishes, chordates, animals) |
| Source | Myxine glutinosa (Atlantic hagfish) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
| Pathogen | Gram-positive bacteria: Propionibacterium acnes ATCC 11827 and 33179 (MIC=2 µg/ml), Staphylococcus epidermidi (MIC=2-4 µg/ml), Streptococcus pyogenes (MIC=4 µg/ml), Enterococcus faecium (MIC=4-8 µg/ml), Staphylococcus aureus ATCC 29213 (MIC=8 µg/ml), Clostridium perfringens ATCC 9081 and 13124 (MIC=4-32 µg/ml), Enterococcus faecalis (MIC=32 µg/ml);##Gram-negative bacteria: Bacteroides spp. ATCC 29771, 43935, 12290 (MIC=0.5-4 µg/ml), Shigella sonnei (MIC=2-4 µg/ml), Xanthomonas maltophilia (MIC=2-8 µg/ml), Salmonella Group B (MIC=4-8 µg/ml), Pseudomonas aeruginosa ATCC 27853 (MIC=8 µg/ml), Acinetobacter baumannii (MIC=8-16 µg/ml), Escherichia coli ATCC 25922 (MIC=8 µg/ml), Enterobacter aerogenes (MIC=8-16 µg/ml), Enterobacter cloacae (MIC=8-16 µg/ml), Klebsiella pneumoniae (MIC=8-16 µg/ml). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q71MD7 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15019197 |
Physicochemical Properties
| Residues | 38 |
|---|---|
| Sequence | GWFKKAWRKVKHAGRRVLDTAKGVGRHYLNNWLNRYRG |
| Molecular Weight | 4596.275 |
| Grand Average of Hydropathy | -1.124 |
| Isoelectric Point | 11.739 |
| Charge at pH 7.4 | 9.613 |
| Secondary Structure | Helix: 0.316, Turn: 0.211, Sheet: 0.158 |
| Instability Index | 21.168 |
| Aromaticity | 0.158 |