| ID | DRAMP03151 |
|---|---|
| Sequence | RWKVFKKIEKVGRNVRDGIIKAGPAIGVLGQAKALG |
| Length | 36 |
| Name | Spodoptera cecropins A (insects, invertebrates, animals) |
| Source | Spodoptera litura larvae (Common cutworm) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q9XZG9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11790350 |
Physicochemical Properties
| Residues | 36 |
|---|---|
| Sequence | RWKVFKKIEKVGRNVRDGIIKAGPAIGVLGQAKALG |
| Molecular Weight | 3874.627 |
| Grand Average of Hydropathy | -0.094 |
| Isoelectric Point | 11.166 |
| Charge at pH 7.4 | 6.544 |
| Secondary Structure | Helix: 0.333, Turn: 0.222, Sheet: 0.194 |
| Instability Index | 28.292 |
| Aromaticity | 0.056 |