| ID | DRAMP03509 |
|---|---|
| Sequence | RWKFFKKIEKVGQNIRDGIIKAGPAVAVVGQAASIT |
| Length | 36 |
| Name | Cecropin-A (Insects, animals) |
| Source | Trichoplusia ni (Cabbage looper) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P50724 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8882660 |
Physicochemical Properties
| Residues | 36 |
|---|---|
| Sequence | RWKFFKKIEKVGQNIRDGIIKAGPAVAVVGQAASIT |
| Molecular Weight | 3897.571 |
| Grand Average of Hydropathy | 0.064 |
| Isoelectric Point | 10.565 |
| Charge at pH 7.4 | 4.546 |
| Secondary Structure | Helix: 0.333, Turn: 0.194, Sheet: 0.167 |
| Instability Index | 37.069 |
| Aromaticity | 0.083 |