| ID | DRAMP03126 |
|---|---|
| Sequence | QLKNLACVTNEGPKWANTYCAAVCHMSGRGAGSCNAKDECVCSMT |
| Length | 45 |
| Name | Antimicrobial peptide defensin 3 (AgDef3; Insects, animals) |
| Source | Anopheles gambiae (African malaria mosquito) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q5TWR9, Q2KM07 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 18353100, 16835022 |
Physicochemical Properties
| Residues | 45 |
|---|---|
| Sequence | QLKNLACVTNEGPKWANTYCAAVCHMSGRGAGSCNAKDECVCSMT |
| Molecular Weight | 4724.384 |
| Grand Average of Hydropathy | -0.167 |
| Isoelectric Point | 7.777 |
| Charge at pH 7.4 | 0.44 |
| Secondary Structure | Helix: 0.156, Turn: 0.267, Sheet: 0.267 |
| Instability Index | 33.456 |
| Aromaticity | 0.044 |