| ID | DRAMP03061 |
|---|---|
| Sequence | AAKPMGITCDLLSLWKVGHAACAAHCLVLGDVGGYCTKEGLCVCKE |
| Length | 46 |
| Name | S.calcitrans defensin 1 (Smd1; defensins; Insects, animals) |
| Source | Stomoxys calcitrans (Stable fly) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | O16136 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9326639, 11903625 |
Physicochemical Properties
| Residues | 46 |
|---|---|
| Sequence | AAKPMGITCDLLSLWKVGHAACAAHCLVLGDVGGYCTKEGLCVCKE |
| Molecular Weight | 4736.625 |
| Grand Average of Hydropathy | 0.596 |
| Isoelectric Point | 6.912 |
| Charge at pH 7.4 | -0.473 |
| Secondary Structure | Helix: 0.283, Turn: 0.174, Sheet: 0.326 |
| Instability Index | 26.635 |
| Aromaticity | 0.043 |