Basic Information
| ID | DRAMP01370 |
|---|
| Sequence | MLCKLSMFGAVLGVPACAIDCLPMGKTGGSCEGGVCGCRKLTFKILWDKKFG |
|---|
| Length | 52 |
|---|
| Name | Oh-defensin (O. hainana defensin; spiders, animals) |
|---|
| Source | Ornithoctonus hainana (Venoms) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
|---|
| Pathogen | Gram-positive bacteria: Staphylococcus aureus (MIC=1.25 µg/ml), Bacillus cereus (MIC=25 µg/ml);##Gram-negative bacteria: Escherichia coli (MIC=1.25 µg/ml), Bacillus dysenteriae (MIC=1.25 µg/ml), Pseudomonas aeruginosa (MIC=5 µg/ml).##Yeast: Candida albicans (MIC=1.25 µg/ml). |
|---|
| Hemolytic Activity | [Ref.21538709] It has little hemolytic activity, inducing 7% hemolysis at the concentration up to 200 µg/ml (about 36 µM). |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Free |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 21538709 |
|---|
