| ID | DRAMP03163 |
|---|---|
| Sequence | ATCDLFSFRSKWVTPNHAACAAHCLLRGNRGGRCKGTICHCRK |
| Length | 43 |
| Name | R. prolixus defensin A (RprDefA; insect defensin; Insects, animals) |
| Source | Rhodnius prolixus |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Insecticidal |
| Pathogen | Gram-negative bacterium: Escherichia coli;##Gram-positive bacterium: Micrococcus luteus. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12650692 |
Physicochemical Properties
| Residues | 43 |
|---|---|
| Sequence | ATCDLFSFRSKWVTPNHAACAAHCLLRGNRGGRCKGTICHCRK |
| Molecular Weight | 4747.524 |
| Grand Average of Hydropathy | -0.288 |
| Isoelectric Point | 9.694 |
| Charge at pH 7.4 | 6.563 |
| Secondary Structure | Helix: 0.186, Turn: 0.209, Sheet: 0.186 |
| Instability Index | 38.298 |
| Aromaticity | 0.07 |
