Basic Information
| ID | DRAMP03486 |
|---|
| Sequence | GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH |
|---|
| Length | 42 |
|---|
| Name | Manduca Sexta Moricin (MS moricin; Insects, animals) |
|---|
| Source | Manduca sexta (Tobacco hornworm) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
|---|
| Pathogen | Gram-negative bacteria: Klebsiella pneumoniae (MIC=6.25 µg/ml), Salmonella typhimurium (MIC=6.25 µg/ml), S. typhimurium DT104 (MIC=6.25 µg/ml), Escherichia coli O157:H7 (MIC=6.25 µg/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25 923 (MIC=6.25 µg/ml), Methicillin-resistant S. aureus ATCC 43 300 (MIC=6.25 µg/ml), Methicillin-resistant S. aureus ATCC BAA-39 (MIC=12.5 µg/ml), Listeria monocytogenes (MIC=6.25 µg/ml).##NOTE: MIC is deï¬ned as the lowest peptide concentration that gives no visible growth after overnight incubation in 100% Muller-Hinton broth. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
Q86MA1 |
|---|
| PDB |
2JR8 |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 18265434, 12706633 |
|---|
