Basic Information
| ID | DRAMP03593 |
|---|
| Sequence | DCYCRIPACIAGERRYGTCIYQGRLWAFCC |
|---|
| Length | 30 |
|---|
| Name | Neutrophil defensin 3 (Defensin, alpha 3; HNP-3, HP-3, HP3; Human, mammals, animals) |
|---|
| Source | Homo sapiens (Human) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral(SARS-CoV-2) |
|---|
| Pathogen | [Ref.34206990]Virus:SARS-CoV-2:inhibition of infection in HEK293T-hACE2 cells(approximately 50% inbibition at 1 μg/mL (290 nM)).##Gram-negative bacteria: Escherichia coli ATCC 8739 (vLD50=6.2±0.9 µg/ml), E. coli ATCC 25922 (vLD50=5.9±2.1 µg/ml), Enterobacter aerogenes ATCC 13048 (vLD50=41±9.2 µg/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923 (vLD50=13±2.1 µg/ml), S. aureus ATCC 29213 (vLD50=2.2±0.4 µg/ml), Bacillus cereus ATCC 10876 (vLD50=0.37±0.08 µg/ml).(Ref.2)##NOTE: vLD50, virtual lethal doses (vLDs), equivalent to conventional 50% lethal doses (LD50s). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found in the reference(s) presented |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Cyclization(Cys2 and Cys30). |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
P59666, P11479, Q14125 |
|---|
| PDB |
1DFN, 2PM4, 2PM5 resolved by X-ray. |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 34206990, 4056036, 15616305 |
|---|
