Basic Information
| ID | DRAMP02653 |
|---|
| Sequence | ACYCRIPACLAGERRYGTCFYLGRVWAFCC |
|---|
| Length | 30 |
|---|
| Name | Neutrophil defensin 1 (RMAD-1; primates, mammals, animals) |
|---|
| Source | Macaca mulatta (Rhesus macaque) |
|---|
| Activity | Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram- |
|---|
| Pathogen | Gram-positive bacteria: Staphylococcus aureus and Listeria monocytogenes;##Gram-negative bacterium: Escherichia coli.##Fungi: Cryptococcus neoformans. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
P60030 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 10531277 |
|---|
