Basic Information
| ID | DRAMP02659 |
| Sequence | ACYCRIPACLAGERRYGTCFYRRRVWAFCC |
| Length | 30 |
| Name | Neutrophil defensin 3 (RMAD-3; primates, mammals, animals) |
| Source | Macaca mulatta (Rhesus monkey) |
| Activity | Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-positive bacteria: Staphylococcus aureus and Listeria monocytogenes;##Gram-negative bacteria: Escherichia coli.##Fungi: Cryptococcus neoformans. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot |
P60031, P82318 |
| PDB |
|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 10531277 |
|---|