| ID | DRAMP02664 |
|---|---|
| Sequence | ACYCRIPACLAGERRYGTCFYLRRVWAFCC |
| Length | 30 |
| Name | Neutrophil defensin 8 (RMAD-8; primates, mammals, animals) |
| Source | Macaca mulatta (Rhesus monkey) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P60032, P82318 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 10531277 |
Physicochemical Properties
| Residues | 30 |
|---|---|
| Sequence | ACYCRIPACLAGERRYGTCFYLRRVWAFCC |
| Molecular Weight | 3552.229 |
| Grand Average of Hydropathy | 0.34 |
| Isoelectric Point | 8.941 |
| Charge at pH 7.4 | 3.454 |
| Secondary Structure | Helix: 0.333, Turn: 0.100, Sheet: 0.233 |
| Instability Index | 90.617 |
| Aromaticity | 0.2 |