| ID | DRAMP03613 |
|---|---|
| Sequence | DRCTKRYGRCKRDCLESEKQIDICSLPRKICCTEKLYEEDDMF |
| Length | 43 |
| Name | Beta-defensin 114 (Beta-defensin 14, DEFB-14; Defensin, beta 114; Human, mammals, animals) |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q30KQ6, Q8NES9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865, 11854508 |
Physicochemical Properties
| Residues | 43 |
|---|---|
| Sequence | DRCTKRYGRCKRDCLESEKQIDICSLPRKICCTEKLYEEDDMF |
| Molecular Weight | 5221.99 |
| Grand Average of Hydropathy | -1.012 |
| Isoelectric Point | 6.37 |
| Charge at pH 7.4 | -0.599 |
| Secondary Structure | Helix: 0.209, Turn: 0.093, Sheet: 0.209 |
| Instability Index | 67.109 |
| Aromaticity | 0.07 |