| ID | DRAMP03629 |
|---|---|
| Sequence | GINSLSSEMHKKCYKNGICRLECYESEMLVAYCMFQLECCVKGNPAP |
| Length | 47 |
| Name | Beta-defensin 134 (Defensin, beta 134; Human, mammals, animals) |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q4QY38, A1L4A4 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865, 15489334 |
Physicochemical Properties
| Residues | 47 |
|---|---|
| Sequence | GINSLSSEMHKKCYKNGICRLECYESEMLVAYCMFQLECCVKGNPAP |
| Molecular Weight | 5322.232 |
| Grand Average of Hydropathy | -0.14 |
| Isoelectric Point | 6.726 |
| Charge at pH 7.4 | -0.565 |
| Secondary Structure | Helix: 0.255, Turn: 0.255, Sheet: 0.298 |
| Instability Index | 62.377 |
| Aromaticity | 0.085 |
