| ID | DRAMP02688 |
|---|---|
| Sequence | MFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPLQAKDPWVH |
| Length | 57 |
| Name | Beta-defensin 136 (Defensin, beta 136; primates, mammals, animals) |
| Source | Pan troglodytes (Chimpanzee) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q30KJ3 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865 |
Physicochemical Properties
| Residues | 57 |
|---|---|
| Sequence | MFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPLQAKDPWVH |
| Molecular Weight | 6539.642 |
| Grand Average of Hydropathy | -0.118 |
| Isoelectric Point | 9.122 |
| Charge at pH 7.4 | 4.199 |
| Secondary Structure | Helix: 0.281, Turn: 0.228, Sheet: 0.123 |
| Instability Index | 61.068 |
| Aromaticity | 0.14 |