Basic Information
| ID | DRAMP03814 |
|---|
| Sequence | GILDTLKQFAKGVGKWLVKGAAQGVLSTVSCKLAKTC |
|---|
| Length | 37 |
|---|
| Name | D16W (GGN4 analogue peptide with single substitution) |
|---|
| Source | Synthetic construct |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
|---|
| Pathogen | [Ref.12199716]Gram-positive bacteria: Micrococcus luteus (MIC=25 µg/ml), Bacillus subtilis (MIC=2.5 µg/ml);##Gram-negative bacteria: Klebsiella pneumoniae (MIC=10 µg/ml), Shigella dysentariae (MIC=10 µg/ml), Pseudomonas putida (MIC=100 µg/ml), Pseudomonas aeruginosa (MIC=50 µg/ml), Eshchericia coli (MIC=10 µg/ml), Salmonella typhimurium (MIC=50 µg/ml). |
|---|
| Hemolytic Activity | [Ref.12199716] 1.97% hemolytic activity at 10 µg/mL, 52.9% hemolytic activity at 100 µg/mL against human red blood cells. |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Cyclization(Cys31 and Cys37). |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 12199716 |
|---|
