| ID | dbAMP03695 |
|---|---|
| Sequence | GLMSVTKGVLKTAGKHIFKNVGGSLLDQAKCKISGQC |
| Length | 37 |
| Name | the Hokkaido frog, Rana pirica, Asia&&Brevinin-2PRc |
| Source | the Hokkaido frog, Rana pirica, Asia |
| Activity | Antibacterial |
| Pathogen | Staphylococcus aureus NCTC 8325 (MIC=25µM)&&Pseudomonas aeruginosa ATCC 27853 (MIC=6µM)&&Klebsiella pneumoniae KK3 9904 (MIC=12µM)&&Escherichia coli ATCC 25922 (MIC=3µM)&&Enterobacter cloacae NHTCC 53001 (MIC=6µM)&&Candida albicans ATCC 90028 (MIC=100µM) |
| Hemolytic Activity | Not included yet |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15003829 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | GLMSVTKGVLKTAGKHIFKNVGGSLLDQAKCKISGQC |
| Molecular Weight | 3818.534 |
| Grand Average of Hydropathy | 0.089 |
| Isoelectric Point | 9.789 |
| Charge at pH 7.4 | 4.53 |
| Secondary Structure | Helix: 0.270, Turn: 0.270, Sheet: 0.189 |
| Instability Index | 16.949 |
| Aromaticity | 0.027 |
