| ID | DRAMP04085 |
|---|---|
| Sequence | ATCDLASIFNWNHTLCAAHCIARRYRGGYCNSKAVCVCR |
| Length | 39 |
| Name | K8I,W9F (mutant of Def-DAA defensin) |
| Source | Synthetic construct |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacteria: Staphylococcus aureus strain 21 (IC90=2-4 µg/mL), Staphylococcus aureus strain 4 (IC90=2-4 µg/mL). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 18214975 |
Physicochemical Properties
| Residues | 39 |
|---|---|
| Sequence | ATCDLASIFNWNHTLCAAHCIARRYRGGYCNSKAVCVCR |
| Molecular Weight | 4349.017 |
| Grand Average of Hydropathy | 0.103 |
| Isoelectric Point | 8.942 |
| Charge at pH 7.4 | 3.527 |
| Secondary Structure | Helix: 0.256, Turn: 0.179, Sheet: 0.205 |
| Instability Index | 16.372 |
| Aromaticity | 0.103 |
