| ID | DRAMP18329 |
|---|---|
| Sequence | NSGGAAVVAALGCAAGGVKYGRLLGPWGAAIG |
| Length | 32 |
| Name | Pneumococin N(Bacteriocin) |
| Source | Streptococcus pneumoniae?TIGR4 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 17074857 |
Physicochemical Properties
| Residues | 32 |
|---|---|
| Sequence | NSGGAAVVAALGCAAGGVKYGRLLGPWGAAIG |
| Molecular Weight | 2885.303 |
| Grand Average of Hydropathy | 0.791 |
| Isoelectric Point | 9.312 |
| Charge at pH 7.4 | 1.528 |
| Secondary Structure | Helix: 0.281, Turn: 0.375, Sheet: 0.344 |
| Instability Index | 4.4 |
| Aromaticity | 0.062 |