| ID | DRAMP18375 |
|---|---|
| Sequence | GLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI |
| Length | 51 |
| Name | hBD-5 (human beta-defensin 5) |
| Source | Homo sapiens |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Active against E. coli K12. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12193721 |
Physicochemical Properties
| Residues | 51 |
|---|---|
| Sequence | GLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI |
| Molecular Weight | 5783.628 |
| Grand Average of Hydropathy | -0.61 |
| Isoelectric Point | 8.26 |
| Charge at pH 7.4 | 1.382 |
| Secondary Structure | Helix: 0.216, Turn: 0.275, Sheet: 0.216 |
| Instability Index | 38.939 |
| Aromaticity | 0.078 |