Basic Information
| ID | DRAMP18717 |
|---|
| Sequence | EFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS |
|---|
| Length | 37 |
|---|
| Name | Charybdotoxin (Yellow scorpions, arachnids, Chelicerata, arthropods, invertebrates, animals) |
|---|
| Source | Leiurus quinquestriatus hebraeus |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
|---|
| Pathogen | [Ref.15118082]Gram-positive bacteria: Bacillus subtilis (Inhibition zone=4 mm completely inhibit in PH5.5, Inhibition zone=7 mm incompletely inhibit and Inhibition zone=6 mm in PH7.5 completely inhibit at 10 μg/well), Staphylococcus aureus (Inhibition zone=3 mm incompletely inhibit in PH5.5, Inhibition zone=6 mm incompletely inhibit and Inhibition zone=1 mm completely inhibit in PH7.5 at 10 μg/well);##Gram-negative bacteria: Escherichia coli (Inhibition zone=2 mm incompletely inhibit in PH5.5, Inhibition zone=8 mm incompletely inhibit in PH7.5 at 10 μg/well);##Fungi: Candida albicans (Inhibition zone=13 mm completely inhibit in PH5.5, Inhibition zone=15 mm in PH7.5 completely inhibit at 10 μg/well). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
|
|---|
| PDB |
2CRD resolved by NMR |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 15118082 |
|---|
