| ID | DRAMP03495 |
|---|---|
| Sequence | INNWVRVPPCDQVCSRTNPEKDECCRAHGHAFHATCSGGMQCYRR |
| Length | 45 |
| Name | Psychimicin (Insects, animals) |
| Source | Oiketicus kirbyi (Bagworm moth) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P83421 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | PubMed ID is not available |
Physicochemical Properties
| Residues | 45 |
|---|---|
| Sequence | INNWVRVPPCDQVCSRTNPEKDECCRAHGHAFHATCSGGMQCYRR |
| Molecular Weight | 5134.76 |
| Grand Average of Hydropathy | -0.811 |
| Isoelectric Point | 8.348 |
| Charge at pH 7.4 | 1.518 |
| Secondary Structure | Helix: 0.156, Turn: 0.244, Sheet: 0.133 |
| Instability Index | 33.173 |
| Aromaticity | 0.067 |