| ID | dbAMP03190 |
|---|---|
| Sequence | GIWSSIKNLASKAWNSDIGQSLRNKAAGAINKFVADKIGVTPSQAAS |
| Length | 47 |
| Name | Vejovine |
| Source | |
| Activity | Antibacterial |
| Pathogen | RBCs Source of Human (HC50 =100µM)&&Pseudomonas aeruginosa 6102 (MIC=100µM)&&Pseudomonas aeruginosa 5106 (MIC=17.7µM)&&Pseudomonas aeruginosa 4677 (MIC=50µM)&&Klebsiella pneumoniae 913 (MIC=17.7µM)&&Klebsiella pneumoniae 1262 (MIC=50µM)&&Escherichia coli |
| Hemolytic Activity | Not included yet |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | F1AWB0 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 20969885, 20969885, 20969885 |
Physicochemical Properties
| Residues | 47 |
|---|---|
| Sequence | GIWSSIKNLASKAWNSDIGQSLRNKAAGAINKFVADKIGVTPSQAAS |
| Molecular Weight | 4872.454 |
| Grand Average of Hydropathy | -0.162 |
| Isoelectric Point | 10.172 |
| Charge at pH 7.4 | 3.546 |
| Secondary Structure | Helix: 0.255, Turn: 0.340, Sheet: 0.213 |
| Instability Index | 38.211 |
| Aromaticity | 0.064 |