Basic Information
| ID | DRAMP18442 |
|---|
| Sequence | GVWDWIKKTAGKIWNSEPVKALKSQALNAAKNFVAEKIGATPS |
|---|
| Length | 43 |
|---|
| Name | Smp43 (scorpions, arachnids, Chelicerata, arthropods, invertebrates, animals) |
|---|
| Source | venom, Scorpio maurus palmatus |
|---|
| Activity | Antimicrobial, Antibacterial, Antifungal |
|---|
| Pathogen | Active against B. subtilis NCIMB 8024 (MIC 4 ug/ml), S. epidermidis sp., S. aureus SH100 (MIC 32-64 ug/ml), E. coli JM109, K. pneumoniae NCTC 13439, and C. albicans (MIC 64-128 ug/ml). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 27019370 |
|---|
