Basic Information
| ID | DRAMP00153 |
| Sequence | KVSGGEAVAAIGICATASAAIGGLAGATLVTPYCVGTWGLIRSH |
| Length | 44 |
| Name | NlmA (chain a of Mutacin IV; Bacteriocin) |
| Source | Streptococcus mutans UA140 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Streptococci sanguinis NY101, S. sanguinis ATCC 10556, Streptococcus parasanguinis ATCC 15911, S. oralis TCC 10557, S. mitis ATCC 903, S. mitis ATCC 33399, S. gordonii ATCC 10558, S. crista ATCC 49999, S. sobrinus OMZ176. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot |
|
| PDB |
|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 11133423 |
|---|