| ID | DRAMP00148 |
|---|---|
| Sequence | LSCDEGMLAVGGLGAVGGPWGAAVGVLVGAALYCF |
| Length | 35 |
| Name | Thermophilin 9 (BlpDst; Bacteriocin) |
| Source | Streptococcus thermophilus LMD-9 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 18156339 |
Physicochemical Properties
| Residues | 35 |
|---|---|
| Sequence | LSCDEGMLAVGGLGAVGGPWGAAVGVLVGAALYCF |
| Molecular Weight | 3281.82 |
| Grand Average of Hydropathy | 1.294 |
| Isoelectric Point | 4.05 |
| Charge at pH 7.4 | -2.492 |
| Secondary Structure | Helix: 0.371, Turn: 0.314, Sheet: 0.371 |
| Instability Index | 10.817 |
| Aromaticity | 0.086 |
