| ID | DRAMP00155 |
|---|---|
| Sequence | YSSKDCLKDIGKGIGAGTVAGAAGGGLAAGLGAIPGAFVGAHFGVIGGSAACIGGLLGN |
| Length | 59 |
| Name | BrcA (chain a of Brochocin C; Bacteriocin) |
| Source | Brochothrix campestris ATCC 43754 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9835559 |
Physicochemical Properties
| Residues | 59 |
|---|---|
| Sequence | YSSKDCLKDIGKGIGAGTVAGAAGGGLAAGLGAIPGAFVGAHFGVIGGSAACIGGLLGN |
| Molecular Weight | 5244.956 |
| Grand Average of Hydropathy | 0.778 |
| Isoelectric Point | 8.031 |
| Charge at pH 7.4 | 0.536 |
| Secondary Structure | Helix: 0.271, Turn: 0.390, Sheet: 0.271 |
| Instability Index | 11.22 |
| Aromaticity | 0.051 |