| ID | DRAMP04437 |
|---|---|
| Sequence | GALWGAPAGGVGALPGAFVGAHVGAIAGGFACMGGMIGNKFN |
| Length | 42 |
| Name | Amphipathic pore-forming peptide |
| Source | Streptococcus thermophilus |
| Activity | Antimicrobial, Antibacterial, Antilisterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | O54454 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9162062 |
Physicochemical Properties
| Residues | 42 |
|---|---|
| Sequence | GALWGAPAGGVGALPGAFVGAHVGAIAGGFACMGGMIGNKFN |
| Molecular Weight | 3830.42 |
| Grand Average of Hydropathy | 0.874 |
| Isoelectric Point | 8.231 |
| Charge at pH 7.4 | 0.567 |
| Secondary Structure | Helix: 0.262, Turn: 0.405, Sheet: 0.310 |
| Instability Index | 37.129 |
| Aromaticity | 0.095 |