Basic Information
| ID | DRAMP00877 |
|---|
| Sequence | GIPCGESCVWIPCISAALGCSCKNKVCYRN |
|---|
| Length | 30 |
|---|
| Name | Circulin-A (CIRA; Plant defensin) |
|---|
| Source | Chassalia parviflora |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Antifungal |
|---|
| Pathogen | [Ref.10430870]Gram-positive bacterium: Staphylococcus aureus (MIC=0.19 µM).##Gram-negative bacterium: Proteus vulgaris (MIC=54.6 µM).##Fungi: Candida kefyr (MIC=18.6 µM) and Candida tropicalis (MIC=19.4 µM).##NOTE: Medium with 10 mM phosphate buffer.##[Ref.18008336]Virus:HIV:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=40-260 nM). |
|---|
| Hemolytic Activity | [Ref.10430870] EC50 = 1020 μM against blood type A human erythrocytes. |
|---|
| Cytotoxicity | [Ref.18008336]CEM-SS cells:IC50=500 nM. |
|---|
| N-terminal Modification | Cyclization (N termini to C termini) |
|---|
| C-terminal Modification | Cyclization (C termini to N termini) |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
P56871 |
|---|
| PDB |
1BH4 |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 18008336, 10430870, 9878410, 8920961 |
|---|
