Basic Information
| ID | DRAMP00878 |
|---|
| Sequence | GVIPCGESCVFIPCISTLLGCSCKNKVCYRN |
|---|
| Length | 31 |
|---|
| Name | Circulin-B (CIRB; Plant defensin) |
|---|
| Source | Chassalia parviflora |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Antifungal |
|---|
| Pathogen | [Ref.10430870]Gram-positive bacterium: (L-salt): Staphylococcus aureus (MIC=13.5 µM).##Gram-negative bacteria: (L-salt, H-salt) (MIC µM): Escherichia coli (0.41, >500), Pseudomonas aeruginosa (25.5, 48), Proteus vulgaris (6.8, >500), Klebsiella oxytoca (8.2, 15.6).##Fungi (H-salt): Candida kefyr (MIC=29 µM).##NOTE: L-salt = Medium with 10 mM phosphate buffer; H-salt = L-salt supplemented with 100 mM NaCl.##[Ref.18008336]Virus:HIV:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=40-260 nM). |
|---|
| Hemolytic Activity | [Ref.10430870] EC50 = 550 μM against blood type A human erythrocytes. |
|---|
| Cytotoxicity | [Ref.10430870] It caused 50% cell growth inhibition of mouse fibroblasts at 820 μM.##[Ref.18008336]CEM-SS cells:IC50=500 nM. |
|---|
| N-terminal Modification | Cyclization (N termini to C termini) |
|---|
| C-terminal Modification | Cyclization (C termini to N termini) |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
P56879 |
|---|
| PDB |
2ERI |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 10430870, 18008336, 8920961 |
|---|
