Basic Information
| ID | DRAMP02383 |
|---|
| Sequence | ASFPWSCPSLSGVCRKVCLPTELFFGPLGCGKGFLCGVSHFL |
|---|
| Length | 42 |
|---|
| Name | saBD (seabream beta defensin; fish, chordates, animals) |
|---|
| Source | Sparus aurata (Teleost fish gilthead seabream) |
|---|
| Activity | Antimicrobial, Antibacterial |
|---|
| Pathogen | Vibrio anguillarum (a seabream pathogenic bacterium), Bacillus subtilis (strong activity); Vibrio harvey and Photobacterium damselae (little activity). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 21497909 |
|---|
