Basic Information
| ID | DRAMP18369 |
|---|
| Sequence | VSFPWSCAALSGVCRQGACLPSELYFGPLGCGKGSLCCVSYFL |
|---|
| Length | 43 |
|---|
| Name | ccBD(channel catfish beta defensin) |
|---|
| Source | skin, Ictalurus punctatus |
|---|
| Activity | Antimicrobial, Antibacterial |
|---|
| Pathogen | Active against Gram- E. coli, E. ictaluri, Y. ruckeri, A. hydrophila, A. veronii, Gram+ S. aureus, S. iniae, and S. agalactiae (MIC 12.5-25 ug/ml). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Free |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 28340427 |
|---|
